Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400027023
Common NameLOC102597810
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family BES1
Protein Properties Length: 331aa    MW: 35566.6 Da    PI: 8.8769
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400027023genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasas 89 
                           gg++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqGny+lpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp+  +e++g+s++++
                           689*************************************************************************.************ PP

                DUF822  90 pesslqsslkssalaspvesysaspksssfpspssldsislasaasllp 138
                           p+ss + s+ ss++asp++sy++sp+sssfpsps++d ++++++ s+l+
                           **************************************99886644433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.0E-6234163IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
Nucleic Localization Signal ? help Back to Top
No. Start End Sequence
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3959010.0AF395901.1 Lycopersicon esculentum mature anther-specific protein LAT61 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006342599.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
TrEMBLM1B8X30.0M1B8X3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000398790.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.22e-99BES1 family protein
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95